- EB2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84927
- Rabbit
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Human
- This antibody was developed against Recombinant Protein corresponding to amino acids: SSSGSASKSD KDLETQVIQL NEQVHSLKLA LEGVEKERDF YFGKLREIEL LCQEHGQEND DLVQ
- CSCSC2, EB1, EB2, RP1
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- 0.1 ml (also 25ul)
- EB2
- microtubule associated protein RP/EB family member 2
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Signal Transduction
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
SSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQ
Specifications/Features
Available conjugates: Unconjugated